DPCstruct | MC46985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 207 ± 56 aa |
| Standard deviation of domain lengths | 55.50 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 67.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 58.91 |
| Assigned Pfam label(s) | PF13867- CL0229- PF12998- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4A619 | 24-232 | NFTLMRDLDNRTEEKKAEIDKLAEEYILNVKNLASEQRVDHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENE… |
| E3NBM3 | 1-176 | MDPHYDKLKKDIEKITVVLKRIHVEVPEKIAKEMEKIGELDKRTSEKMAEIEATKVEFIQFYSEMSDADKTSACSYIEKELEIAESW… |
| A0A077WEZ5 | 20-182 | None |
| A0A7S3LLV4 | 48-207 | None |
| A0A813TLD7 | 6-230 | None |
| A0A2A2KU04 | 298-436 | None |
| A0A821GKX6 | 1-137 | None |
| A0A182K2H3 | 2-232 | None |
| A0A498P408 | 1-118 | None |
| A0A0C3BIB4 | 10-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.