DPCstruct | MC46983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 278 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9WJR3 | 1-250 | MIENLRIWYQSTRKKVAYFMLALVFSYIFLAISLISGSSPSIILGALCLTLVVPFSMFAMLATDNSVFDSLQSKKWVVITVGLVITI… |
| W1RXP8 | 42-310 | LPVNRALYLQGSIELNIKDQITEKLNKAKQWIANTKKKYLNFFYALIFSYIALFFTIYLQFPKSLVLIVLILTLIIPFAMVLMILTE… |
| A0A1X0N494 | 4-305 | None |
| A0A4Y8G1X9 | 34-327 | None |
| A0A850N938 | 29-346 | None |
| A0A8A6Y2C2 | 14-233 | None |
| Q4ZW70 | 46-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.