DPCstruct | MC4698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139A5C0 | 4-97 | LNAQLIDAVESGREDDVKRLIDAGASPDLRKVVTMRAKVDTGRGWLLGAELKEDTAACESALAIAILHGIAPVVRVLLEMGAKVDSE… |
| A0A139A844 | 53-156 | ALAEKLIEAVEKRRLDLLRSALAAGADPNARKRITLTVSVPGFGTRSETVFGESALVLAVLYAQDALVQELLDAGANVHAEVEWRVP… |
| A0A139AFZ9 | 3-94 | None |
| A0A139AH28 | 18-138 | None |
| A0A139AH87 | 9-122 | None |
| A0A139AHH6 | 6-92 | None |
| A0A139AHN8 | 5-104 | None |
| A0A139AJ62 | 3-108 | None |
| A0A139ANS9 | 9-126 | None |
| A0A139AKK1 | 4-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.