DPCstruct | MC46976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 141 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10150 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7MXF4 | 494-635 | PQSQTLGISAKIDEEDERRRLRDILSPWLGELPLGYIVRTNAEDQSEEALTFDITYLGKVWRVVQENIVKAKVGERVYEELALPLRS… |
| A0A2V8GZN0 | 164-297 | VGVSRKIDSREERSRLRGIVREFREQNGFTGGVIIRTAAASRPKEDIVSDLSYFHKVWTEIRQKSESSRAPAVVYREASLVAKLLRD… |
| A0A803MAT1 | 310-470 | None |
| A0A1M7TML8 | 573-712 | None |
| A0A7M3MRU7 | 129-290 | None |
| A0A2Z5QZS6 | 168-313 | None |
| A0A1M3LSX8 | 4-133 | None |
| A0A2S8RE83 | 136-273 | None |
| A0A819BHT1 | 634-757 | None |
| A0A022S118 | 284-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.