DPCstruct | MC46972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 185 ± 35 aa |
| Standard deviation of domain lengths | 35.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8E755 | 130-302 | PDIFLKMQAFRLKFRKKYLDPECRSILEGAFDYFITKIDNMDLKQDIVYTHLNSKQIKHLPLYYQEMINAYYKIKSNFKIDFQVQHV… |
| A0A3P9DUQ4 | 30-186 | VLDFTTLNNTFKINWAKHFLKNPVSIWNFIPHYIFSKFGGLSFILGCDYNIDKLPEKLSMFHKQVLLAWSLIYKHNFTPHTYSIWNN… |
| A0A483A9H0 | 15-172 | None |
| A0A388KPB4 | 207-466 | None |
| A0A2G8LQH5 | 680-853 | None |
| A0A6J8DVT9 | 412-584 | None |
| A0A6J8DFE8 | 56-233 | None |
| A0A432IAH7 | 80-232 | None |
| A0A432I8S5 | 247-396 | None |
| A0A3M6TRI1 | 69-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.