DPCstruct | MC4697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 450 ± 67 aa |
| Standard deviation of domain lengths | 66.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5JYB8 | 13-401 | EEEIEREKQAADDIVKKMPPEKQAKYAEMKAVNEELLQELAARQDELDALMTRKETFEAELEHSQVKQEAVVLYERLHELELRRDAL… |
| A0A139A4E2 | 124-593 | EREAAQGDAWAKKSAHLSATLATLLAHLADLNLALERAHAGADPEDLIREAKEVGGRSGPGGKGQEAEGVMGVRRSKEALLRDLEAQ… |
| A0A067BQG6 | 41-443 | None |
| A0A6P5C773 | 38-479 | None |
| A0A6P3V7Z7 | 5-535 | None |
| A0A673KNX4 | 5-397 | None |
| A0A7R9T7T3 | 2-323 | None |
| A0A5J4VGI9 | 94-592 | None |
| A0A3Q0KN72 | 107-593 | None |
| Q6DHU7 | 49-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.