DPCstruct | MC4696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 184 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139A4A7 | 1-171 | MTALSFFGCLLTAYGPALVIFFGYVARDPTLTILSISSAFFWLLSLLLSALIWRIVAPLQSSLPFSVVVGVISQELFRWLYYMLLSR… |
| I1LJR0 | 1-204 | MTVAAGIGYALVALGPSLSLFVSVISKKPFLILTVLSSTLLWLISLIVLSGIWRGVLPLSTTASWPFGILIFSSVAFQEALRLFFWK… |
| A0A482VJ65 | 1-171 | None |
| A0A818BN16 | 459-661 | None |
| T1H1U1 | 1-142 | None |
| A0A6V7XQP9 | 1-223 | None |
| A0A0V0RRU5 | 898-1099 | None |
| A0A5A8CXP7 | 2-230 | None |
| A0A670YY65 | 1-148 | None |
| A0A3P7NTI2 | 2-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.