DPCstruct | MC4695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 150 ± 36 aa |
| Standard deviation of domain lengths | 35.97 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.86 |
| Pfam Score | 60.92 |
| Assigned Pfam label(s) | CL0175- PF21373- PF18268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139A274 | 8-141 | VCGVCNLEPPKYKCPTCLINYCSLACFKNHKAIGCTKPEPVVPPHSADEPKAGIALEDEDDAALTDEQLRALGTDPAIRALLSSPDL… |
| A0A0C9W277 | 1-167 | MPPRSRPVCQVCRKDESKYSCSSCRANYCSVACYKEHKVSPPTDAVEDPKPLRPLTSLNWPYVPEESAYPDPLKRDDPKPLQLPQYE… |
| A0A4Y7NJI5 | 5-139 | None |
| A0A6P5VVD3 | 37-181 | None |
| A0A815U434 | 231-325 | None |
| A0A0M3QVC2 | 558-696 | None |
| A0A182JGA0 | 4-139 | None |
| A0A4Y7NG32 | 111-217 | None |
| A0A1C7NGS9 | 3-114 | None |
| A0A445AFX2 | 4-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.