DPCstruct | MC46949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7W7E5 | 5-132 | CKALDSFEERVVGCTNKVDEDIPLLRPSCTIPLLLMCEVHVARLLRHNSCPSCGLFCTQGIFLQCREKHFFHKGCEIVKNDVPVCPH… |
| A0A1Y1JXQ3 | 403-516 | VYCTAIDNIGDRLVGCSRIVNGHEICLMRPSPRVPFIILCEVHLNRMIRHNCCPKCGLFCTQGQFAQCEAKHQYHRECQLTVAGNDY… |
| A0A0S7K264 | 15-172 | None |
| A0A4Y2UUY6 | 727-850 | None |
| B3RNP4 | 134-275 | None |
| A0A674AUR7 | 116-277 | None |
| A0A673IHT7 | 42-181 | None |
| A0A182HE42 | 60-236 | None |
| A0A6P5A2Q7 | 283-411 | None |
| M9PGH7 | 806-985 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.