DPCstruct | MC46944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 219 ± 31 aa |
| Standard deviation of domain lengths | 30.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067GR12 | 1-218 | MATAYKKMTSICLSIKNEIFTDIEIHNQHTLPSFVDLPNLSSSIYSTELAGRLHAFLVACPPSGPSPHVAELIIATADFQKDLTSWK… |
| A0A453NKX8 | 107-284 | SAAYLKMKTLCINISLEIQADIKIHDQNILPSSIDLPNIAASLYSTELCKRLKGFLSASPPSRPLQHVAELLIATANFERDLDSWQV… |
| A0A816JE65 | 123-361 | None |
| A0A6A3CCX8 | 264-439 | None |
| A0A3L6RR18 | 1-220 | None |
| A0A7J0FG32 | 395-633 | None |
| A0A7J7QQL3 | 621-839 | None |
| A0A067GNA7 | 1-212 | None |
| A0A453PLP2 | 149-403 | None |
| A0A0A9MTJ0 | 1-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.