DPCstruct | MC46943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 2 aa |
| Standard deviation of domain lengths | 1.92 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 62.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067GLJ1 | 1-64 | MVYFHDIPDEVIDNLIEEGITFNVAGGLMLEHPLTLPFVEAVVGATDTVMGLSKALTEKLIWEA |
| A0A388LVX8 | 197-260 | AEVYFHPIPPQVVEQLIQEGSVFWAAGGLLVEHPLVSPLVEAMVGTLDSVMGLPKALTSSLIDD |
| A0A444XZW7 | 250-315 | None |
| A0A438K1P5 | 11-74 | None |
| A0A3L6S728 | 277-341 | None |
| A0A1U7WFB7 | 110-180 | None |
| K7MNV8 | 83-146 | None |
| A0A835I5S8 | 217-280 | None |
| A0A7S0EP22 | 55-119 | None |
| A0A2K1ZN77 | 88-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.