DPCstruct | MC46940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 243 ± 29 aa |
| Standard deviation of domain lengths | 29.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182GDQ0 | 3-184 | AWDDETGVKDYVIRNYFKPADTDTVYESRTQDCLRVKLAGLDRCAVFDRAYRSFMCYYQNYGNIVQEAQFVPWYQVEREKHLREVFL… |
| A0A182KCT0 | 36-286 | YQKAQKDCVVMMSINPLRLEQYRKFVYPPDRDTMCLIRCIGITLDFWDDTLGFDLDLAEQELSPLVDATFKKQLAENITLKLELLDP… |
| A0A023EPA2 | 12-243 | None |
| Q17PF9 | 9-287 | None |
| Q17LZ5 | 275-539 | None |
| Q17FU5 | 92-297 | None |
| Q16Y73 | 13-270 | None |
| A0A0N0P9Q2 | 6-249 | None |
| A0A151WRI5 | 31-299 | None |
| A0A226ERU0 | 28-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.