DPCstruct | MC4694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.68 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | CL0043- PF01502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139A1M9 | 81-175 | DRSDGLYTTVVVDEQRVALGVAYSSVKSISEAIRSGNGVYHSRSRGLWIKGLTSGAVQKLLRMDVDKDCLRFMVHQDGPGFCHLNTR… |
| C2UST3 | 2-86 | IEEDTKEVLMLAYMNEEAYEKTLETKRTWFYSRSRQSLWNKGETSGNMQYVQSLYLDCDQDSIVVVVKQVGPACHTGEKTCFHYK |
| A0A5B8T7B6 | 10-111 | None |
| A0A497SAR6 | 25-97 | None |
| A0A2A2K604 | 12-96 | None |
| A0A2N2PSP6 | 7-110 | None |
| A0A7T5M862 | 19-118 | None |
| A0A5J4YKL0 | 73-180 | None |
| A0A1H7ID84 | 88-200 | None |
| A0A520R432 | 49-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.