DPCstruct | MC46938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X2B5 | 1-48 | MGSLKALQEWCRIQCESYNDVDIKNMSSSFRDGLAFCAIIHRYRPDLM |
| A0A182K7M2 | 3-51 | ERRGTKALELWCRRLAEGYKDVKITNMSTSWRDGLAFCAIIHNFRPDLM |
| A0A3P7LPE6 | 13-67 | None |
| A0A1A9XIB2 | 62-112 | None |
| A0A5K3FV07 | 21-77 | None |
| A0A6I9NEU0 | 51-108 | None |
| A0A834JSC9 | 2-51 | None |
| A0A2J8TZG4 | 267-326 | None |
| A0A1B0ARU8 | 115-166 | None |
| A0A2I4D4S6 | 166-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.