DPCstruct | MC46928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 168 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FX56 | 2-187 | RSFLVSFSCLDTFLYSRLKIVSNCKNDSRTSLVKLDYTVLHQVLLENDIKLHILMNEVFRVDKDRVNKMFYGIDSINAYTKKDFKNL… |
| A0A846C754 | 38-235 | AVGGGKFGTANEFANATNNLLLSGGVEDGYSAIDFALNNYTFREGVAVNFILVTDEYRNNRNFSLNFTNILEGLQRGTADTSDDILL… |
| A0A7R9AR93 | 151-314 | None |
| A0A2B4SKD7 | 126-282 | None |
| A0A7R9Q6N4 | 431-610 | None |
| A0A1I8F568 | 11-158 | None |
| T1PCB1 | 905-1066 | None |
| A0A7R9ADR1 | 43-213 | None |
| A0A267E9Q0 | 37-203 | None |
| A0A182T4X5 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.