DPCstruct | MC46923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 6.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.68 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0199- CL0402 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B9R1 | 1-96 | MGFSLLQRKWATLSIGQDIDVRTHHFDPTSSSECLCTIMLEVDFLQKKTTTLEPYDSDAMAREFLLQFSGQAFTVGQLLAFNFSDDK… |
| A0A819PJZ7 | 50-158 | YVFTIIKYGSMSQGKIGFNTLQRRWAGIELDRSYQIRPYIFDKNVQSIATLVLAVDFLNKKNTTTDPYDTDKMALEFLQQYMDHAFS… |
| T1GCV4 | 572-677 | None |
| A0A1I7WNC9 | 16-128 | None |
| A0A565AQ43 | 29-133 | None |
| A0A7R9BFW7 | 410-520 | None |
| A0A0R3XBY3 | 2-114 | None |
| A0A183D3F6 | 63-159 | None |
| A0A4P9YN65 | 46-153 | None |
| A0A060VZJ5 | 135-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.