DPCstruct | MC46921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 51 ± 3 aa |
| Standard deviation of domain lengths | 3.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 84.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7P8B5 | 1-52 | MISLIIPPKDQIARVNKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLY |
| V5IFF0 | 42-91 | LIIPPKDQISRVSKMLADEFGTASNIKSRVNRLSVLGAITSVQHRLKLYT |
| A0A816IS05 | 35-83 | None |
| A0A1A8VMK4 | 27-84 | None |
| A0A1W0A7U4 | 39-88 | None |
| A0A195D7E1 | 37-86 | None |
| T1GK94 | 1-58 | None |
| A0A6V7PBY3 | 100-148 | None |
| A0A662YGA8 | 586-634 | None |
| A0A1J1IPL8 | 37-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.