DPCstruct | MC46919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1P1R8 | 24-198 | AAATAKKLESRQTTLIEVVQSLGEYINDEDAKIRTRAVSYLTAIISSLPRAFLSRQQIDVLCDFLCARIEDGGALEGLSKLQSLDRF… |
| A0A7R9B6C7 | 2-175 | IHISEHSYKLVTLVEHLGDLLTNLNPEFRRKGILTLAYVLDNLPVDFLGPDDLQYLVTFFCDRLKDHHTVIPATLQGIRAIVKMDLP… |
| A0A6A4WPE6 | 37-215 | None |
| R4X873 | 25-198 | None |
| A0A0R3QD99 | 5-167 | None |
| K1RGI6 | 1-202 | None |
| A0A183JIA9 | 3-174 | None |
| A0A430Q140 | 5-182 | None |
| A0A2T9XYK0 | 26-195 | None |
| A0A0N4YQ82 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.