DPCstruct | MC46917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3NBE1 | 244-317 | ISQELYEFCLDQGHADRNLIAKWKKQGYERLCCLRCIQTRDHNFATTCVCRVPRHLREEQVIECVHCGCKGCAS |
| A0A1R1X7C9 | 21-95 | ISFEVYDYCLQKKLADANLIAKWKKPGFEKLCCLRCIQPRDTNYGTACICRVPKGKLEEGRTVECVHCGCRGCAS |
| A0A0N0NNJ3 | 173-262 | None |
| A0A7J5YCM3 | 124-181 | None |
| A0A4S9U0I9 | 163-237 | None |
| A0A6U4NMS9 | 71-144 | None |
| A0A368G3A8 | 201-262 | None |
| A0A1I8C291 | 4-70 | None |
| A0A7J6LB89 | 342-416 | None |
| A0A5J4Z1H4 | 66-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.