DPCstruct | MC46909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 217 ± 42 aa |
| Standard deviation of domain lengths | 41.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832C8Y4 | 16-215 | SVHGVLKIVSIPFISALIGWFTNYLAVRMIFHPYQPLGLGPLKIQGLVPKRREELAISIGKTVSNHLISHADIANSLKSIQVVESLK… |
| A0A847SNP0 | 2-190 | IFFLPLIAALIGWLLNSLATTLLFRPYQPVKIGFITLQGVFPKRQAQLAAGIGAMVAGNFSFEDIKRKLTDPEKIKKIIPLVETHLD… |
| A0A2S8BGH9 | 22-230 | None |
| A0A2S8BGN1 | 33-229 | None |
| A0A7S2CKA4 | 18-205 | None |
| A0A7S4MQJ6 | 1-177 | None |
| A0A847IMH8 | 18-303 | None |
| D8LT84 | 168-407 | None |
| A0A448ZNI0 | 3-175 | None |
| A0A0W8CUP5 | 161-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.