DPCstruct | MC46907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553Q8L2 | 59-173 | RRPIRRRDGTFNYSPDVYCTKYDETTGICPDGDDCPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPHDLRP… |
| A0A0G4IHE6 | 144-263 | HSKHTRRKPVLVSADEYNYAPTRCRYVQTSHGKRRCPQGDACRYAHSTEEMIYHPLVYKTQLCPHALQNGICTGFGQHCAKAHGPGE… |
| A0A833S0G8 | 368-494 | None |
| A0A7J6CGU1 | 517-629 | None |
| A0A368GEW4 | 89-224 | None |
| A0A5K4ETY8 | 57-186 | None |
| A0A3P7IR20 | 37-156 | None |
| A0A0S7L2A1 | 88-218 | None |
| W6UD36 | 771-884 | None |
| A0A7I8V955 | 7-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.