DPCstruct | MC46904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 479 ± 65 aa |
| Standard deviation of domain lengths | 65.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0125- PF16602- CL0175- CL0190- PF06337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5VEL8 | 3-471 | AVSMRSRSRSTELSPEEERILIRDIALAAEANSKEGDIFYLLTQRWWQHWIDYVNQDQPNNANDVSFVSEHYDSAGSSTLKRPAGID… |
| A0A2H2IH92 | 70-526 | FEDRASKLPLTEWNIVAESWHSEFRTLLEADKNPNPIDNSGIKGTREDSWTSKVACISSESARLKPDLQQSDYIRVPVPLWRAWLRW… |
| A0A1V8V053 | 290-893 | None |
| A0A099P385 | 39-524 | None |
| A0A5B7DF72 | 140-663 | None |
| A0A0P1AXX0 | 410-920 | None |
| A0A165FUP6 | 24-524 | None |
| A0A817H5L6 | 361-829 | None |
| A0A5N5LW60 | 350-840 | None |
| A0A1J4K860 | 2-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.