DPCstruct | MC469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 218 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5AUG4 | 57-260 | VLNQVDLKRLQGAIAEAEKKTVGEILPVIVERSDAHPQAAWIAGLFSFLFGSALLAAWLPWDQPVALLASQLAMGLVGYLLARVLPD… |
| A0A432TA98 | 2-206 | VMKINPTEKEHIREAIIQAEAHTSGEIVTVIAQKSDRYLYISLFWSALLALCFPAFFLLMDWYLPIHYLLASQLMLFCLFWLIIDKT… |
| A0A353PUG9 | 9-231 | None |
| A0A4R0P2Z7 | 2-224 | None |
| A0A3R7VJ03 | 109-306 | None |
| U2JZB4 | 11-275 | None |
| A0A7V8BGD6 | 74-285 | None |
| B8EPJ6 | 3-205 | None |
| A0A0H3BJ67 | 46-279 | None |
| A0A1H9H1U4 | 5-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.