DPCstruct | MC4689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8KKQ7 | 2-91 | KSLGVIETRGLVAAVQAVDAACKAAGVSCIGYRKIGSGLVSVCFEGEISAIHTAIERGVEVVAAGQVVGSLVIARPERSVVDALGKL… |
| A0A3S0QRP2 | 2-80 | IETRGLIGSIEAADAMVKAANVNIVGKVHVGGGIVTVLVTGDVGAVKAATEAGSEAARRVGELLSVHVIPRPHSELLAI |
| N2BZ20 | 6-76 | None |
| A0A2H0FNW3 | 3-95 | None |
| A0A846DFA1 | 15-123 | None |
| A0A117L823 | 5-96 | None |
| A0A5P2F1W1 | 2-93 | None |
| A0A257SPS6 | 5-81 | None |
| A0A7Y3BXI0 | 2-83 | None |
| A0A2E0W5M4 | 4-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.