DPCstruct | MC46888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067FMX8 | 78-169 | EVPTRASGAALGRDQSTIGEALEATALSAGDKAVDQRDAAAIYAAEARASATNEIKPGGIGSRAQSAATQNERTTFFSDKITISDVS… |
| A0A7J8ZTW2 | 196-289 | QPDVSAVTTPAMLVDPGSITIGEALEAAAISAADKPIDQSDAAAIQAAEMRATGSSEITPGGIASEAQSAATRNARTQRFEDQATLS… |
| A0A6A5LM60 | 669-768 | None |
| A0A5B6VZT2 | 311-407 | None |
| A0A2T7C6M4 | 1-122 | None |
| A0A2J6KTF8 | 198-286 | None |
| A0A2S1WLQ8 | 166-250 | None |
| A0A6P6AX84 | 1-91 | None |
| A0A6L2MGF5 | 55-151 | None |
| A0A453LT39 | 19-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.