DPCstruct | MC46887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 32.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8AMW4 | 2-182 | FRVKLLHCFLWDYFSSLPGWDSASSSIHHHISKNLFSLKDAFRAMPLQLFLQVVGSTQKADDIMKKYKQVMRLSELPSEEYKLLMDT… |
| A0A4U5N1U8 | 83-309 | AIIHEILYHFVYSFDNFEGLPNVYERFPPALSVDEIKAEEVPVYVDADTPTRFMPPLPPFSNAQQGWFMLQDFLNVFPLSVYVLLMP… |
| A0A3Q0FMD2 | 33-235 | None |
| A0A821T4P2 | 851-984 | None |
| A0A1U8PLQ5 | 279-504 | None |
| A0A820VC16 | 1-141 | None |
| A0A5B8MTN1 | 586-788 | None |
| A0A5N4CXN0 | 435-585 | None |
| A0A821IME6 | 569-715 | None |
| A0A0E0PRF7 | 419-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.