DPCstruct | MC46883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 229 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 95.85 |
| Assigned Pfam label(s) | CL0667- CL0072- PF13012- CL0738- CL0232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2EJY9 | 8-91 | ESDASNFERQVETALEKIRPALQADGGDIELLEVVGRNARVRLVGACHGCPSARFTLQAGVQEFLRQEVPGFGDVIDDTPDDGY |
| A0A1G5WUN8 | 3-80 | DPVALDAALGRARPLILGHGGDIAITEVSDDGVVSVALTGACRACPNLAMTFVGPVRTFLMEVPGVSAVECDQVNAGP |
| A0A7R8XDX2 | 286-374 | None |
| M1UVC6 | 436-521 | None |
| A0A316P369 | 5-85 | None |
| A0A2N9IE58 | 58-150 | None |
| A0A7J6CQV1 | 887-970 | None |
| A0A7S2SCE1 | 259-353 | None |
| A0A0D3CCR6 | 129-202 | None |
| S7J777 | 3-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.