DPCstruct | MC46873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8C298 | 165-270 | IDDHLNVLPIFSNALNITPLHPNQKNDKSPKQLELQQLKQSLGDSKPIGPLLAKCKTYCQGKVLLQLLDASMEKTNLNSICSITAAR… |
| A0A2G8K170 | 82-186 | DDELNILPLSSHVVNIEAVPRKTQEDALSPHEKELKELKESLQDTQPVGALINCSKTLDQGKALLKFVEAISEKTLRSTVCMTAARG… |
| A0A4S4DDW7 | 651-779 | None |
| A0A2J7ZM05 | 93-203 | None |
| A0A2I0TDS5 | 107-201 | None |
| B9RDL3 | 120-249 | None |
| A0A0B1TMG6 | 61-214 | None |
| A0A3Q0JG08 | 189-291 | None |
| A0A3N4JXG2 | 278-382 | None |
| A0A6V7W607 | 81-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.