DPCstruct | MC4687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.41 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF04315- PF08891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9I945 | 34-120 | QGQFEDVEVKPQALEWLFCVAAGFPFNVSCDNLEGDFEPDRIVFQRRVHAQVMDYLEKGIPERPARLIKALQNYYHTPEITAECFPW |
| A0A3P8ITW8 | 2-78 | TQRQFEDVEVKPQAFDWLFCVAAGFPFNVSCDNLEGDVEPDRIAFQRRVHAQVMSYLEQGIPERPARFIQALQNIIK |
| A0A2A5ASW9 | 88-173 | None |
| A0A5N8TEI8 | 89-178 | None |
| A0A6I1J896 | 7-81 | None |
| A0A2S6VS79 | 31-95 | None |
| A0A0H3KYC2 | 196-282 | None |
| L8J851 | 58-143 | None |
| A0A0A2VYD9 | 301-389 | None |
| A0A0J7J9U9 | 89-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.