DPCstruct | MC46868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9HVB8 | 31-121 | SPLPVNCREEMYPCTRMYSVHRPVKTCVGYLCFYSLPRVYVINNEICVRTVCQHEEYLKAELCRELSGWPKRLQRSPSRKRCRSRRD… |
| A0A3B5QIB5 | 68-159 | ITLPSHCREEMYPCTRMYSVHRPIKTCLGRLCLYSLPRVYVINNEICVRTVCQQDEYLKAELCRELSGWPKRIARSSSGKRCRSRRN… |
| A0A7J7Z603 | 25-132 | None |
| A0A673YTU7 | 4-96 | None |
| A0A3B5A8D1 | 71-156 | None |
| A0A3Q3XG60 | 1-88 | None |
| A0A7F8R698 | 91-187 | None |
| A0A667GM40 | 100-186 | None |
| L5LX78 | 151-240 | None |
| A0A670KHT7 | 119-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.