DPCstruct | MC46862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5ENB9 | 1-93 | MLKFLSKLQVKRRTGDHPPEIKVTFVNGAEEVFDATTISAKNIRQMILEKGEHIETEQMFRDNNETWPVIIPQEELYQSFPLTKAKK… |
| A0A218X0M7 | 200-273 | KRRTDEHPPQITVTFVNGVEEVFDATSTPAQNIRTMILEKGQYLETEQMFHEAGEAWPVIIPDEELHQFAPGTK |
| A0A2T7DAH8 | 88-175 | None |
| A0A7J6EWZ2 | 12-94 | None |
| A0A199VTM8 | 48-124 | None |
| A0A835DXM0 | 42-113 | None |
| A0A6P5MD30 | 145-231 | None |
| A0A834Y936 | 46-136 | None |
| A0A0E0CJ98 | 201-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.