DPCstruct | MC4686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 3.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6WFD1 | 1-49 | MKQGKKPTRAEKAVIASYNLNPANWLICKKVNDMYTLQHRLTGKIRDIP |
| A0A2C1K445 | 15-69 | GEALAKNGNNPTKKEKLLIKSHNLNPDNWLVYKKGDNKLHLVHRNTCTTRVIQSA |
| F0SX58 | 1-50 | None |
| A0A174ZXW3 | 2-48 | None |
| A0A4Y8LKC0 | 35-83 | None |
| A0A268E9Y2 | 81-130 | None |
| A0A1Q9I8H8 | 4-59 | None |
| C7HAI8 | 11-64 | None |
| R7BGK1 | 1-56 | None |
| A0A4Z0R0P2 | 50-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.