DPCstruct | MC46859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 214 ± 49 aa |
| Standard deviation of domain lengths | 48.68 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0179- CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5E184 | 1-184 | MYAERTAKGNVLEPEGMIEIKFRTKELLECMGRLDQHLINLKESLQAARGSGDPGVVEALKVQIRSREKQLLPVYTQIATRFAELHD… |
| A0A7S2RG88 | 10-171 | MHRIDPQLQMLDAELEATDDTDQDAQEAIKEQIAAREDLLKPVYLQAATEFADLHDKTGRMKAKGVIKDSVPWARSREYFFYLAKRR… |
| A0A4P9Y308 | 526-800 | None |
| A0A7S3LWC0 | 356-686 | None |
| A0A7R9PVD6 | 469-740 | None |
| K3WVL2 | 239-471 | None |
| A0A821UC68 | 971-1236 | None |
| A0A1S3J5V5 | 744-1006 | None |
| A0A7S2C7V9 | 1-134 | None |
| A0A7S3TPJ3 | 61-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.