DPCstruct | MC4685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A323TBG0 | 38-150 | DFDLFIAEEKKRVEDPKREAKHGWFFKTAQELGEETLTYFASTSIRRYMRRLVEAGWLEERCNPKHKWDRTTQYRVHLINIQKDLHE… |
| A0A2C1HK25 | 1-113 | MKFAKSRAELFEQIELTHGWIYKTADDMSDETMLGMSKSSIGRHLETLLKEGWLERRKNPNWKGDNTYQYRVDILKVQKDLFKKGYF… |
| Q2LTX0 | 55-149 | None |
| A0A0K8MB72 | 38-146 | None |
| A0A7C7EG41 | 1-121 | None |
| A0A7W1M9S6 | 44-160 | None |
| A0A358T5U6 | 68-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.