DPCstruct | MC46847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6LCK4 | 739-838 | TAWVNMVTQYGKPLLPKMHYLQPISVRHIDWLRHQAMLIVAARLARAEPPLRRETVEYMLDVDYHMWSLRRSKANFGRIMKLLTGVA… |
| A0A087GZM3 | 986-1089 | RFSCTSMFQMLLQYWKPLLPKMHYARPLKVVQQEILRQHAVNLVAARLSRAEPPLRKEVIEYISDSNSHFWSMRKSRANLFRLRSVF… |
| A0A7J6W3L5 | 36-147 | None |
| A0A3N7FQG0 | 1-117 | None |
| A0A3P6CIK1 | 58-171 | None |
| A0A2P5XBX0 | 600-697 | None |
| A0A835IKS8 | 1-101 | None |
| A0A2N9HMB9 | 696-802 | None |
| A0A287XTC5 | 200-301 | None |
| A0A1R3IE56 | 891-995 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.