DPCstruct | MC46846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HG07 | 40-161 | MQVGNCCKGGVLSSWVQDPVNAVASFQITVGRSGTSNRTVKAPKNFTLKAPGPGYTCGAAQKVKPPTKFISPDGRRTTQAHVTWDVI… |
| A0A2G3BDY7 | 1-120 | MQTTNCCKGEVLTSMTQDLGKYGASFEMGIGSASDDGSGPRIPENFTLGIPSYTCGQPFPVPPRKFSVDKGRRKTKEVAMWDVICTY… |
| A0A7J9G2I8 | 3-104 | None |
| A0A6P5S076 | 24-141 | None |
| A0A4Y7KKT0 | 249-363 | None |
| Q9SEC8 | 40-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.