DPCstruct | MC46845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 509 ± 44 aa |
| Standard deviation of domain lengths | 44.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 55.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3BAC0 | 32-532 | WSVYCALSDLCFGDQGLDLGPTLRELCAANRSETQQIKALLQSAGTAFCPNYLDWFGDDDSGSHSRNADRSVVSKFLQSHPADFSTR… |
| A0A1Y2CC27 | 96-511 | DPGVEGKVSHAQKGEEWVDVHLASTKNTRADLADFLESNNVTAVFELADDDFEEHILEYPPGKRGLYLHGINKNQCVPLETWDSVRV… |
| A0A0K9QPT8 | 251-705 | None |
| A0A1U8FYA9 | 399-940 | None |
| A0A287HEC1 | 256-809 | None |
| A0A2P2M277 | 2-543 | None |
| A0A453AW62 | 126-679 | None |
| A0A2P5VRF4 | 331-805 | None |
| M8ASH2 | 30-510 | None |
| A0A164TPJ3 | 21-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.