DPCstruct | MC46844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 223 ± 32 aa |
| Standard deviation of domain lengths | 32.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0TSB5 | 2-174 | TLAHQLATGQKTTHDAIDDGFNKRAFRDRDGLPEWFNDDEGKHDKPQKPITKAAAMAIKEKLRAFNARPIKKVREAKARKKFKTAQR… |
| A0A2G3B7E7 | 30-220 | LSDESDESGDNINGKAAILCAGKKMTLKRQRELMMDDGYNKYMFHDEGLPKWFIDEEKRHRQPIKKEEVAAMKTQFKAINARPAKKV… |
| A0A314YCC0 | 39-271 | None |
| A0A2G2XBK7 | 213-407 | None |
| A0A7S3PN43 | 515-745 | None |
| A0A1Q9CNT9 | 100-307 | None |
| A0A830HG72 | 709-952 | None |
| A0A7R9JLC2 | 1-125 | None |
| A0A7S0BF78 | 346-578 | None |
| A0A1X1BIN5 | 623-856 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.