DPCstruct | MC4684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8CA31 | 5-87 | TNHPITWLTVVALILATLFGHFWVWGSLFLWWAYTSFIAGEAFIGEIVNIRENPPLFWTVTVMWFFLGAYYVVQDLAWRLFGI |
| A0A7K1Z162 | 44-129 | TNNRSPQTPRWVNVVALAVLLVATLMNWMWIWGILFIYWAVPAFLTSETHLVGPISRDTQPVIFWLVTVLWIVLGVVTILLDLAPG |
| A0A837E3K0 | 2-78 | None |
| D5EKN1 | 248-329 | None |
| A0A5S9PKX8 | 27-107 | None |
| A0A3M2EBL4 | 1-79 | None |
| A0A0B8QFD1 | 51-128 | None |
| A0A1B7XEJ0 | 5-73 | None |
| A0A6L7NG94 | 2-89 | None |
| A0A1N6V6V7 | 23-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.