DPCstruct | MC46833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 84.29 |
| Assigned Pfam label(s) | PF04560- PF04997- PF04998- PF04983- PF00623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1IR73 | 111-233 | GDYILLKRQPSLQRMSLMAFRARMMPDSCTIRINPCVCPAFNADFDGDEMNIFCASSYPSKAECDVLLAIDKYILSPQNSMPTIYTI… |
| J9HM71 | 128-223 | EHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARVLMLSSNNILSPASGRPITSPTQ… |
| A0A5S6Q651 | 428-530 | None |
| A0A1A9X8V1 | 151-254 | None |
| A0A4Y2UKG3 | 28-152 | None |
| A0A5D3DCE3 | 402-539 | None |
| A0A446MYX7 | 4-125 | None |
| U6KTH3 | 318-458 | None |
| A0A4U6TSJ4 | 87-206 | None |
| A0A6D1GKE3 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.