DPCstruct | MC4683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 347 ± 34 aa |
| Standard deviation of domain lengths | 33.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5W373 | 78-429 | YKTLVWMSYDRENLYFAFRCLDPEPEKIKTSITRRDSMFYDDWVGLSLDALGTKQTAWALFVNPNGIQGDILDSAVSGSDPSPDFVW… |
| A0A7K1Z107 | 2-375 | GVICYDREPEEIIVSDTRRDAPLDETDSFQMILDTYLDGQNGFVFGTNPAGIEYDAQVTNEGQGGFGARQQAGSGGGFNINWDGSWD… |
| A0A7V8XCI4 | 62-457 | None |
| A0A848QIC1 | 1-301 | None |
| A0A7W1C5D7 | 269-656 | None |
| A0A2W5YQK0 | 68-395 | None |
| A0A651HQK2 | 307-670 | None |
| A0A2E2VW90 | 70-444 | None |
| A0A2V7XNE7 | 86-408 | None |
| A0A838RC49 | 68-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.