DPCstruct | MC4682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 460 ± 75 aa |
| Standard deviation of domain lengths | 74.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1Z0Q0 | 6-501 | LPSDEVLKQLEDLVQKKLIERITVKNKKRWKVTEAGKVKFSGVRIGVDSRIDNVVNTIFAGCEPIAEYREALLECLSTIFGRIADRY… |
| W7YU78 | 3-338 | EKIYFGSVIAGFLESGIDVNAKFLSGEEYFIDTQIILRGLDLQNESDTQPAKELIDLIIKLQGKPKYLGITLSELSHILEVSIENYN… |
| A0A6A8KEI2 | 2-431 | None |
| A0A1G7S123 | 72-542 | None |
| A0A3P3W993 | 47-419 | None |
| A0A7Y5EXW4 | 196-749 | None |
| A0A4R1J0E2 | 2-501 | None |
| A0A1F2V859 | 68-498 | None |
| A0A7L5EHF2 | 208-765 | None |
| A0A3M3GUE5 | 66-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.