DPCstruct | MC46817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 106 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0S8V6 | 9-106 | FWMEEWGEKSNDLNENIMVAEIYYETYPKMIPIYSHRYIPSEPHKTGNPVFSIYQTDIIYYGYDLAHYFAHEFRFELSDKFPIIDAP… |
| A0A7X1D5G0 | 23-113 | FWLQSWGVKPDLVTERIRVAKEKYDVAPKLVPVYSHRYMPEGSEQVLSVYQTDIIFHGTTLLEYFQIELDWKPYERMDFENIKVIPF… |
| A0A7N0T553 | 74-198 | None |
| A0A066YI40 | 1-69 | None |
| A0A7N0TDP7 | 57-211 | None |
| A0A1I3DJD7 | 32-125 | None |
| A0A6A6L5X1 | 94-230 | None |
| A0A3N7B444 | 6-84 | None |
| A0A443N661 | 218-342 | None |
| A0A1S1NJY3 | 67-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.