DPCstruct | MC46809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T5Z5V7 | 1-86 | MIRELSVKDEADLTVSGTAYDFLLLLSGREDPDTLFFQRHLQMVGDTDLGVHLKNMLAALDPDSLPLPGSFQPMLQRCLSAYERFA |
| A0A2A5CSL5 | 38-111 | PVESQASLSIDTINAIRLIQQEIDPDTLFFQRQLTIAGDTELAHQMKNTIDTFNQDLIPSVVMKLLSEYQARIL |
| A0A7V2WGY0 | 1-75 | None |
| A0A447TUV1 | 4-73 | None |
| A0A1I3KV28 | 7-85 | None |
| A0A2D6CPP3 | 177-245 | None |
| A0A7W5J0X4 | 194-259 | None |
| A0A7X8UZK1 | 84-170 | None |
| A0A447TKI9 | 30-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.