DPCstruct | MC46806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19609 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KFL3 | 15-134 | WRESFRAWRWQRPFWAGLLSLLAGLPIMYFPYNDVNAGGFTINMSTTAGSASLIIGVLLVVLGLTMWFQPMVRVFAGVATILLGLVS… |
| A0A0D4DE01 | 2-115 | IRQRFRRWRHTRPFPAGLCSVAAGVELIAVVGTAPGSLSLSGAGAPASWLLATLMIVAGLTMWLDPPRRYYAGAMTLICGLLSLLLS… |
| A0A4P6F6I1 | 2-120 | None |
| A0A429FRS0 | 9-121 | None |
| A0A150HJF7 | 2-111 | None |
| A0A381KJL5 | 8-156 | None |
| L7L6Q2 | 1-127 | None |
| A0A4R4Q1P7 | 20-137 | None |
| A0A6V8K8F4 | 9-125 | None |
| A0A498L0T0 | 269-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.