DPCstruct | MC46802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7N5M7 | 15-97 | DALKTVKLEDFKDVNRIPCARNALLYGIVAGVTVGAVRFATKRMIPTSANWAVGTFCGVSIISFEGCQMERKQKIEKMRLIVK |
| G0S2Y6 | 57-142 | EALASIKPSDFLTIHQKPCARPGLLTGIGAGAVVGILRFIIGAPVPKAANWAVGTAVVGAIGQYEYCQYQRRQEKEKVKRVVQVYA |
| A0A238FBZ6 | 26-163 | None |
| A0A1V8SR66 | 24-125 | None |
| G2TRP9 | 1-120 | None |
| A0A177VCU2 | 17-104 | None |
| A0A4T0FL19 | 29-114 | None |
| A0A1Y2FIJ2 | 32-118 | None |
| A0A420HSE7 | 53-154 | None |
| A0A0W4ZFZ8 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.