DPCstruct | MC4680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432MMK5 | 5-103 | DPTYRNARREAIVILSVWLASTVYCCVYAYFAGYQRSGHPLGVGDIRPVLGIPSWVFWGVMAPWLVCSVFTVWFAGWKMADDDLGLD… |
| A0A6L8C975 | 4-77 | AFRRARREALHILVAWGICMIWTIGYCAFFAYGSGDISLLWGMPQWVVFGIALPWVIATLYSLWFALFYMKAED |
| A0A2E5VLE5 | 9-96 | None |
| A0A518JRF4 | 82-189 | None |
| A0A7C7T0K8 | 58-149 | None |
| A0A2E7RSK5 | 2-106 | None |
| A0A7C4Z9A4 | 1-104 | None |
| A0A845R7I2 | 26-112 | None |
| A0A5M6CVY7 | 26-134 | None |
| A0A518HBA6 | 3-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.