DPCstruct | MC468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 3.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3TFI3 | 5-54 | KLEMDILKVASKAVKEAQRKSLENGVANVYAKNGTIYFQLPDGTITQQIP |
| A0A2G2N1A0 | 1-50 | MNESDIIQIIGNKAVKEAQRKNLENGIANVYSKNGVMYFQLPDGTITMDN |
| A0A258X1L9 | 8-57 | None |
| A0A1I5U2U0 | 59-111 | None |
| A6DN64 | 7-60 | None |
| A0A518K3J1 | 14-64 | None |
| R7M951 | 1-53 | None |
| A0A1F3JX80 | 6-67 | None |
| A0A2M9ZY60 | 13-69 | None |
| A0A518KVU6 | 15-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.