DPCstruct | MC46799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 273 ± 42 aa |
| Standard deviation of domain lengths | 42.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7NDW9 | 12-234 | IERDFSLPTRNYQGYLDLATYCKSKGVTRKATTGLEELCRRVLKRYLPKGDYTPRQSEWSAAKLSESQIEYAVNDAYVALDIFNALS… |
| A0A2H3CGN9 | 49-239 | NVHAHKPELEQDDAIQVSTAWDNLTLTLEQEAYASLDVFAISLIYDAFLQLPIGGPVTDATVGGTVVKLISRNKSSMVAYGVIAPDQ… |
| A0A168MFQ8 | 193-441 | None |
| K0R618 | 1-270 | None |
| A0A284RYK3 | 97-450 | None |
| D7G0J2 | 137-419 | None |
| A0A146I326 | 130-364 | None |
| A0A0C3D1A9 | 121-423 | None |
| A0A0D0C6W1 | 270-545 | None |
| A0A0D0BA31 | 235-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.