DPCstruct | MC46797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6AUD2 | 3-102 | KEQLYAAQTAMIEWLSDSHELGKKPFKIECAGEFDFNEMHYYIFKFKASLLGKWLVGVCGGFEDDDLEPCGHIFSNMQEYNETTAKN… |
| A0A7X2T266 | 1-84 | MDLKGQAVTDMIEWLSDEHELGKAPSKIEVAGEFDYDDAHYYILKFKKSFLGKWLVGVSGYDENGESFGHTFSEFVVYNEKTAA |
| A0A1H9BE97 | 1-91 | None |
| A0A3Q9G8M2 | 8-79 | None |
| A0A1Q6KVG2 | 16-120 | None |
| A0A413VZB3 | 2-101 | None |
| B0MZA5 | 5-88 | None |
| A0A484F538 | 130-216 | None |
| A0A807YJS9 | 142-246 | None |
| R9M4H8 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.